PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G30950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 298aa    MW: 31467.1 Da    PI: 7.4829
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G30950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP96.16.7e-3054130379
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                      g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++ +   +++ 
  OPUNC01G30950.1  54 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPQDHLCMGHHL 130
                      78*************************************************************99999444222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.5E-2755117IPR005333Transcription factor, TCP
PROSITE profilePS5136929.95155113IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MILGSNQAAA AAAAAAAEEE AAELARKHTA AVATSRQWSA QTESRIVRVS RVFGGKDRHS  60
KVKTVKGLRD RRVRLSVPTA IQLYDLQDRL GLNQPSKVVD WLLNAARHEI DKLPPLQFPP  120
QDHLCMGHHL PSAMPLMHHH HHHHHADDDK YHVTAAAAVL AAEKGATGGG DDVDGGGGSG  180
AAHMVGRFPA GGYHRFMGLN NPLGMVNSAG AAMPFHYAGE SWNNGSVQDS GAGSPQVAAA  240
AAAAHHTSPF PSLLSLAPGS HHQLVFYSSE AEQFTVDNLG SQSLSLSSAR AFHDQTGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0719640.0AK071964.1 Oryza sativa Japonica Group cDNA clone:J013079O19, full insert sequence.
GenBankAP0032740.0AP003274.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0512C01.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankCT8322130.0CT832213.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN047P02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626531.11e-160PREDICTED: transcription factor PCF6-like
RefseqXP_015626542.11e-160PREDICTED: transcription factor PCF6-like
TrEMBLA0A0E0JP190.0A0A0E0JP19_ORYPU; Uncharacterized protein
STRINGBGIOSGA000770-PA1e-160(Oryza sativa Indica Group)
STRINGLOC_Os01g55750.11e-160(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.19e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5